PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D05G0393
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 199aa    MW: 23123.1 Da    PI: 8.6193
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D05G0393genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding66.74.2e-211764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++l+++v+ +G+++Wk++a++ g++R++k+c++rw +yl
      Gh_D05G0393 17 RGAWTAEEDQKLAQVVEIHGPKRWKAVAAKAGLNRCGKSCRLRWMNYL 64
                     89********************************************97 PP

2Myb_DNA-binding50.83.9e-1670115148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
      Gh_D05G0393  70 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 115
                      78999*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.5751268IPR017930Myb domain
SuperFamilySSF466892.27E-3015111IPR009057Homeodomain-like
SMARTSM007172.4E-171666IPR001005SANT/Myb domain
PfamPF002494.6E-201764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-251871IPR009057Homeodomain-like
CDDcd001678.77E-121964No hitNo description
SMARTSM007171.9E-1569117IPR001005SANT/Myb domain
PROSITE profilePS5129420.91869119IPR017930Myb domain
PfamPF002491.6E-1470115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-2572120IPR009057Homeodomain-like
CDDcd001671.22E-974115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MSMAPTSTKC SKKEVNRGAW TAEEDQKLAQ VVEIHGPKRW KAVAAKAGLN RCGKSCRLRW  60
MNYLRPNIKR GNISDQEEDL ILRLHKLLGN RWSLIAGRLP GRTDNEIKNY WNSHLSKKIK  120
QNEKQTRMQE PVLENSKVSE REEPLHKASE EGSSKRDEEY STSCFNGDSS LFDLYNKEPL  180
ELEWMSHFFE TDEVWLNLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-31141191105MYB PROTO-ONCOGENE PROTEIN
1h8a_C6e-311411924128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5822972e-68JX582297.1 Gossypium hirsutum clone NBRI_GE15106 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012440738.11e-145PREDICTED: transcription factor MYB114-like isoform X2
SwissprotQ388503e-54MYB5_ARATH; Transcription repressor MYB5
SwissprotP102907e-54MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLA0A0D2RTT01e-145A0A0D2RTT0_G
STRINGPOPTR_0006s23780.19e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.12e-55myb domain protein 5